Hannaford Deals 7/27-8/2

hannafordSince shopping at Market Basket in the foreseeable future isn’t an option, I am going to post the deals to be found at Hannaford as well as continue to post the deals at Shaw’s.  Keep in mind that prices can vary slightly between Hannaford locations.

Meat & Seafood:

Boneless Skinless Chicken Breast $1.78/lb, 3-5 lb package
USDA Choice Shoulder Steak for London Broil $2.99/lb
Boneless Pork Sirloin Steak $1.99/lb

Johnsonville Fresh Breakfast Sausage $3.29
-$1/1 HERE
=$2.29 after coupon

Deli:

Taste of Inspirations Black Forest Ham $6.99/lb
Carolina Turkey Breast $3.99/lb
German Bologna $2.49/lb

Galbani Fresh Mozzarella Cheese $3.99
-$1/1 or $3/2 HERE
=as low as $2.49 each after coupon

Produce:

Blueberries $1.88
Hannaford Red Potatoes 4 lb bag $1.99
Koru Apples $1.29/lb

Marie’s Salad Dressing $2.99
-$1/1 HERE
=$1.99 after coupon

[Read more...]

Garlicky Zucchini Noodles

IMG_3195

If you have a vegetable garden or frequent farm stands, you may have noticed that zucchini season is in full swing.  I’m always on the lookout for recipes using our zucchini bumper crop and when I spotted this recipe in the newest issue of Better Homes & Garden, I knew I had to try it.  It was delish! Nice combination of flavors, sweet and salty along with crunchy of the nuts and the softness of the “noodles.”

Garlicky Zucchini Noodles

source: Better Homes & Garden, August 2014

2 medium zucchini
3 Tbsp walnut oil or olive oil
6 cloves of garlic, smashed, peeled and halved
1/2 cup walnut pieces
1/4 tsp crushed red pepper
4 thin slices prosciutto, torn
1 medium green apple, thinly sliced
4 oz soft goat cheese

1. Using a spiral vegetable slice (like this one I just bought from Amazon.com), cut zucchini into long thin noodles.
2. In a large skillet heat 2 Tbsp of the oil over medium-high heat. Add garlic. Cook, stirring constantly, 2 minutes or until just starting to brown.
3. Add zucchini; cook and toss with tongs for 1 minute. Transfer to a serving bowl.
4. Add walnuts to the skillet and stir for 1-2 minutes until toasted. Add to bowl with zucchini. Add 1/2 tsp kosher salt and crushed red pepper and toss.
5. Add remaining 1 Tbsp of oil to the skillet and then add prosciutto. Cook 1 minute or until browned and crisp. Add to zucchini mixture along with the apples. Top with goat cheese.

Makes 6 servings.

217 calories
18g fat
13 mg cholesterol
405g sodium
9g carbs
2g fiber
8g protein

Attention Market Basket shoppers…

savemb

I know many of you visit This Mama Knows to get the deal match ups for Market Basket, the Google analytics info tells me that.  So, I am sure you are well aware of the debacle going on at all Market Basket stores, empty shelves and parking lots that are ghost towns—minus the store employees and supporters holding signs in support of the ousted CEO, Arthur T. Demoulas.

I am just amazed (and I am not using that word lightly) that so many employee and customers are flocking to support a person.  But after reading countless stories about Arthur T.’s selfless acts and generosity, I am not surprised one bit.  I was in a Market Basket store last Saturday morning and the shelves were already becoming bare.  Again for curiosity’s sake, I stopped in on Monday and the situation was even worse, no produce, no fresh meat, no seafood and the other shelves were only about 1/4 the way stocked.  For that reason, in addition to supporting the protesters I did my grocery shopping elsewhere this week.  My wallet took a bit more of hit than normal, but I just had to get creative and deal with it.

If you are a Market Basket shopper and feeling the pain in the wallet for having (or choosing) to shop elsewhere, here are some suggestions for you:

  • Hannaford: If you aren’t familiar with Hannaford, they are a great store, the produce and meat are really high quality.  You can even check the prices of nearly every item they carry in a particular store on their website.  You can also view their sales flyer online as well.  Their prices do vary slightly depending on the location.
  • Shaw’s:  Yes, Shaw’s is expensive for most things, but if you shop just their sale items and use coupons, you can find some great deals there that even beat Market Basket prices.  The best deals this week at Shaw’s can be found here.
  • Shop local farmers markets or farm stands, meat markets and local stores.  For example, my local small town convenience store has a butcher counter and sells ground beef for $3.99/lb.  It is ground fresh to order and is from a local farm and is the best tasting beef.
  • Trader Joe’s:  The past two weeks I have done my grocery shopping at Trader Joe’s.  Its not convenient for me to go that often, but I love the stuff they carry.  The organic produce is very reasonable ($2.99 for 3 pack of romaine hearts!) and they have a nice selection of gluten free items too.  Their frozen pizzas are some of the best as well.  They also accept manufacturer’s coupons.

For those that are interested in keeping up with the latest new about the Market Basket strike and protest, check out several Facebook pages that have been set up:

-Save Artie T. & Save Market Basket

-Save Market Basket

FREE $5 Dunkin Donuts Gift Card + FREE Medium Beverage

dunks

TODAY only, when you download the Dunkin Donuts app and sign up for the DD Perks program, you have the chance to score a FREE medium beverage and an additional $5 Dunkin Donuts gift card when you load an existing card to your account.  Here’s how: first download the free app onto your phone, open the app and follow the prompts to sign up and load a card onto your account.  When you load the card, use the promo code BONUS5 and a $5 gift card will be added to your account! The coupon for the free medium beverage will be emailed to you instantly as well.  FREE ice lattes are calling my name!

Shaw’s Ad Scan + Coupon Match Ups 7/25-7/31

Here is the preview for next week’s Shaw’s ad starting Friday. To view the Shaw’s ad scan, go here.

3 Day Sale-Friday, Saturday, Sunday:

Sanderson Farms Split Chicken $1.49/lb

Hass Avocado .88

Red or Yellow Mangoes .88

Tide 92-100 oz $8.99, Limit 1
-$1.50/1 HERE
=$7.49 after coupon

Hood Ice Cream or Novelties $1.99, Limit 4
-$1/2 HERE
=$1.49 each after coupon

Poland Spring Water 24 pack $2.99

Live Chicken Lobster $5.99/lb

Meat & Seafood:

Pork Sirloin Chops $1.49/lb
Eye Round Steak $4.29/lb
Fresh Boneless Chicken Breast $2.99/lb

Pick 4 $19.99:
*Perdue Perfect Portions
-$1/1 HERE
*Ground Beef 80% Lean
*Johnsonville Italian Sausage or Bratwurst
-$1/1 HERE
*Boneless Center Cut Loin Chops
*Marinated Turkey or Chicken Tips
*DiLuigi Shaved Steak
*Lloyd’s St. Louis Jr. Ribs
-$1/1 HERE
*Perdue Bagged Chicken

Deli:

Ham, all brands $5.99/lb
Dietz & Watson Chicken Breast $8.99/lb
Dietz & Watson Cheese $5.99/lb

Kayem Artisan Sausage $4.99
-$1/1 HERE
=$3.99 after coupon

Produce:

Northwest Cherries $2.47/lb
Maine Broccoli Crowns .99/lb
Green Peppers $1.49/lb

[Read more...]

Market Basket Ad Scan + Coupon Match Ups 7/20-7/26

 

Here’s what you can find for deals in this week’s Market Basket ad. To view this week’s actual Market Basket ad scan, go here. This ad is good from 7/20 through 7/26.

Also, don’t forget you will get an extra 4% off your purchase now through December 27th, 2014! Exclusion: beer, wine, cigarettes/tobacco, dairy milk, gift cards, lottery stamps & town trash bags.

Meat & Seafood:

Boneless Pork Tenderloin $3.69/lb
Split Chicken Breast $1.49/lb
Boneless Top Round Roast $3.29/lb

Perdue Perfect Portions $5.99
-$1/1 HERE
=$4.99 after coupon

Deli:

Market Basket Vienna Bologna $2.99/lb
Willowbrook Farm Fancy Turkey Breast $3.99/lb
Sorrento Provolone Cheese $3.49/lb

Krakus Imported Ham $3.99/lb
-$1/1 HERE
=$2.99 for 1 lb after coupon

Applegate Farms Organic Beef Hotdogs $4.99
-$1/1 HERE
=$3.99 after coupon

Produce:

Golden Ripe Pineapple 2/$4
Tender Green Beans .99/lb
Organic Red or Green Seedless Grapes $2.79/lb

[Read more...]

ENLIGHTENED Ice Cream Giveaway

IMG_3185

If you have perused your ice cream aisle lately (admit it, you have!) you may have noticed a new product called ENLIGHTENED Ice Cream that offers a better-for-you ice cream option.  ENLIGHTENED Ice Cream is all natural, low in calories, high in protein and fiber.  It also contains only 3 grams of sugar and just 2 grams of fat. Did I also mention that is very tasty and comes in some mouth watering varieties? Yep it does.

enlightenedCheck out the available flavors:

  • Fudge
  • Orange Cream
  • Coffee
  • Peanut Butter
  • Toasted Almond
  • Vanilla Bean Sandwiches
  • Mint Sandwiches

I recently tried the Vanilla Bean Sandwiches and was quite pleased with the flavor and texture.  It was very much like a classic ice cream sandwich, but with only 100 calories, it was a diet bargain for sure.  My husband is into fitness and nutrition recently commented that the nutrition is similar to a protein bar, giving you a 8 grams of protein.  He seems to think that these are his new pre-workout snack! Needless to say I have to hide them from him now.

To find a store near you that carries ENLIGHTENED Ice Cream, use the store locator found on their website.  While you are on their website, be sure to also sign up for their email newsletter to stay up to date on the latest promotions and coupons.

tmkheadingenglightenedgiveaway
a Rafflecopter giveaway

Deadline for entries is Saturday August 16th at 12:01 am EST. The winner will be contacted via email and has 48 hours to respond before a new winner is selected. This giveaway is open to residents of the US only, age 18 years or older. By entering this giveaway you are agreeing to my terms of use.

Goodluck!

Disclosure: I was provided product samples and additional compensation, but any opinions expressed are my own personal and honest thoughts.

Shaw’s Ad Scan + Coupon Match Ups 7/18-7/24

Here is the preview for next week’s Shaw’s ad starting Friday. To view the Shaw’s ad scan, go here.

3 Day Sale-Friday, Saturday, Sunday:

St. Louis Pork Ribs $2.88/lb

Large Cooked Shrimp $6.99

Tomatoes on the Vine $1.49/lb

Fresh Express Premium Salad $1.49
-$1/2 HERE
=.99 each after coupon

Bumble Bee Solid White Tuna 5/$5

Green Mountain Bagged Coffee or K-Cups $4.99

Dannon Light & Fit, Oikos or Activia Greek Yogurt or Muller Corners yogurt .88
-$1/4 Dannon Oikos Red Plum 6/1
-$1/3 Dannon Light & Fit
=as low as .55 each after coupon

Meat & Seafood:

Fresh Boneless Chicken Breast $1.99/lb, 3 lbs+
Boneless Center Cut Pork Chops $2.99/lb, 3 lbs+
Sirloin Tip Steak $6.99/lb

Deli:

Dietz & Watson Turkey Breast $7.99/lb
Maple Creek Ham $4.99/lb
Land O Lakes Italian Cheese $5.99/lb

Butterball Turkey Bacon $1.49
-$1/2 SmartSource 5/18
-.55/1 SmartSource 6/29
=as low as .39 each after coupon doubles

Produce:

Blueberries 2/$3
Broccoli Crowns .88/lb
Cut Seedless Watermelon .69/lb

[Read more...]

Attention Homemade Jam/Jelly Lovers: $2 off sugar printable coupon!

$2.00 off on C&H Sugar & 2 SURE•JELL Pectins
We are at the tail end of strawberry season here in New England, but blueberries, raspberries and blackberries are just around the corner.  If you are looking to do some canning this year, perhaps making your own jam, definitely print this coupon that good for $2 off sugar when you buy 2 Sure-Jell pectins!  It just so happens that Domino Sugar 4 lb bags are on sale at Market Basket for $2 starting on Sunday, so great timing.  Market Basket does sell Sure-Jell pectin, it is in the vinegar aisle.

If you need an easy recipe for Strawberry Jam, check out this previous post with step by step instructions. If I can do it, so can you!

Market Basket Ad Scan + Coupon Match Ups 7/13-7/19

 

Here’s what you can find for deals in this week’s Market Basket ad. To view this week’s actual Market Basket ad scan, go here. This ad is good from 7/13 through 7/19.

Also, don’t forget you will get an extra 4% off your purchase now through December 27th, 2014! Exclusion: beer, wine, cigarettes/tobacco, dairy milk, gift cards, lottery stamps & town trash bags.

Meat & Seafood:

Certified Angus Ground Round $3.99/lb
Boneless Pork Chops $2.69/lb
Boneless Chicken Breast $2.49/lb

Deli:

Jennie-O Turkey Breast $3.99/lb
Market Basket Premium Ham $4.99/lb
Finlandia Swiss Cheese $4.99/lb

Farmland Sliced Bacon $4.69
-$1/1 HERE
=$3.69 after coupon

Produce:

Golden Ripe Pineapple 2/$5
Stem Cluster Tomatoes .99/lb
Romaine Lettuce .99

Fresh Express Baby Blends 2/$4
-$1/2 HERE
=$1.50 each after coupon

[Read more...]

Related Posts Plugin for WordPress, Blogger...